![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_1961.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 75aa MW: 8693.8 Da PI: 8.4993 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 50.5 | 4.8e-16 | 1 | 48 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT+eE ++l d+vk++G+g W+ I ++ g++R++k+c++ w +yl
evm.model.supercontig_1961.1 1 KGLWTAEEGKILMDYVKLHGKGKWNHICNKTGLNRCGKSCRLSWINYL 48
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-19 | 1 | 51 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 5.1E-8 | 1 | 50 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.0E-14 | 1 | 48 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 21.984 | 1 | 52 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 4.34E-20 | 3 | 74 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.72E-8 | 4 | 48 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 8.8E-7 | 52 | 74 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
KGLWTAEEGK ILMDYVKLHG KGKWNHICNK TGLNRCGKSC RLSWINYLSP NIMQDSFSEE 60 EEDLIIRLHK LLGNX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_1961.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC238629 | 1e-66 | AC238629.1 Carica papaya BAC clone 84J07, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012081531.1 | 8e-37 | transcription factor WER | ||||
| Swissprot | Q9SEI0 | 2e-36 | WER_ARATH; Transcription factor WER | ||||
| TrEMBL | A0A067LKV6 | 2e-35 | A0A067LKV6_JATCU; MYB family protein | ||||
| STRING | evm.model.supercontig_1961.1 | 7e-48 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G14750.1 | 9e-39 | myb domain protein 66 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_1961.1 |




