![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_20.45 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 153aa MW: 16981 Da PI: 10.0823 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 103.9 | 1.4e-32 | 57 | 113 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rak+e e+k +ksrkpylheSRh hAlrR+Rg+gGrF
evm.model.supercontig_20.45 57 EEPVFVNAKQYHGILRRRQSRAKAETENKA-IKSRKPYLHESRHLHALRRARGCGGRF 113
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 5.4E-36 | 55 | 116 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 37.353 | 56 | 116 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.8E-27 | 58 | 113 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 1.3E-23 | 59 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 61 | 81 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 1.3E-23 | 90 | 113 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MKAPGAYPYP DPYYRSIFAP YDAQPYPSQP YAGQPMVHLQ LMGIQQAGVP LPSDAVEEPV 60 FVNAKQYHGI LRRRQSRAKA ETENKAIKSR KPYLHESRHL HALRRARGCG GRFLNSKKNE 120 NQQNEAASGD KSQPSINLNS DKNDITSTNG TS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 4e-21 | 56 | 121 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_20.45 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021903689.1 | 1e-108 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
| Refseq | XP_021903690.1 | 1e-108 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
| Refseq | XP_021903691.1 | 1e-108 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
| Refseq | XP_021903692.1 | 1e-108 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
| Refseq | XP_021903693.1 | 1e-108 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
| Refseq | XP_021903694.1 | 1e-108 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
| Refseq | XP_021903695.1 | 1e-108 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
| Swissprot | Q84JP1 | 1e-67 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A2I4GVD2 | 5e-99 | A0A2I4GVD2_JUGRE; nuclear transcription factor Y subunit A-7 | ||||
| STRING | evm.model.supercontig_20.45 | 1e-110 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4168 | 27 | 56 | Representative plant | OGRP680 | 16 | 72 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 2e-60 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_20.45 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




