PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.model.supercontig_2067.2

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

MYB_related

Protein Properties

Length: 50aa MW: 5579.47 Da PI: 10.2828

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_2067.2	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	33.5	9.7e-11	5	34	1	30
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +++WT+eE+ l +v ++G g W+tI + evm.model.supercontig_2067.2 5 KQKWTPEEEAALRAGVVKHGAGKWRTILKD 34 79*************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.952	1	50	IPR017930	Myb domain
SuperFamily	SSF46689	9.33E-12	2	50	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.5E-11	4	50	IPR009057	Homeodomain-like
Pfam	PF00249	8.8E-8	5	33	IPR001005	SANT/Myb domain
CDD	cd11660	4.15E-13	6	50	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 50 aa Download sequence Send to blast
MGAPKQKWTP EEEAALRAGV VKHGAGKWRT ILKDPEFSGV LYLRSNVDLK

Functional Description ? help Back to Top
Source	Description
UniProt	Binds preferentially double-stranded telomeric repeats. {ECO:0000269\|PubMed:19102728}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_2067.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021889377.1	9e-30	telomere repeat-binding factor 1-like
Refseq	XP_028123872.1	5e-29	telomere repeat-binding factor 1-like
Swissprot	Q8VWK4	5e-26	TRB1_ARATH; Telomere repeat-binding factor 1
TrEMBL	A0A438D794	4e-27	A0A438D794_VITVI; Telomere repeat-binding factor 1
STRING	XP_010542089.1	3e-27	(Tarenaya hassleriana)
STRING	Gorai.005G230800.1	3e-27	(Gossypium raimondii)
STRING	evm.model.supercontig_2067.2	2e-29	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16580	8	12
Representative plant	OGRP855	16	59

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G49950.3	2e-28	telomere repeat binding factor 1

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_2067.2

Publications ? help Back to Top
Alexandrov NN, et al. Features of Arabidopsis genes and genome discovered using full-length cDNAs. Plant Mol. Biol., 2006. 60(1): p. 69-85 [PMID:16463100] Schrumpfová PP, et al. Telomere repeat binding proteins are functional components of Arabidopsis telomeres and interact with telomerase. Plant J., 2014. 77(5): p. 770-81 [PMID:24397874] Liang SC, et al. Kicking against the PRCs - A Domesticated Transposase Antagonises Silencing Mediated by Polycomb Group Proteins and Is an Accessory Component of Polycomb Repressive Complex 2. PLoS Genet., 2015. 11(12): p. e1005660 [PMID:26642436] Fulcher N,Riha K Using Centromere Mediated Genome Elimination to Elucidate the Functional Redundancy of Candidate Telomere Binding Proteins in Arabidopsis thaliana. Front Genet, 2015. 6: p. 349 [PMID:26779251] Kotliński M, et al. Phylogeny-Based Systematization of Arabidopsis Proteins with Histone H1 Globular Domain. Plant Physiol., 2017. 174(1): p. 27-34 [PMID:28298478]