![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_287.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 141aa MW: 15399 Da PI: 6.2617 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 169.7 | 3.4e-53 | 26 | 120 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84
e++++lPianv+rimk++lP+nakisk+aket+qecvsefisfvt+eas+kc+re+rkt+ngdd++wala+lGf+dyv plk
evm.model.supercontig_287.4 26 EHEKLLPIANVGRIMKQILPSNAKISKEAKETMQECVSEFISFVTGEASEKCRRERRKTVNGDDVCWALASLGFDDYVGPLK 107
7899****************************************************************************** PP
NF-YB 85 vylkkyrelegek 97
yl+kyre+ege+
evm.model.supercontig_287.4 108 RYLHKYREAEGER 120
**********997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 7.4E-50 | 24 | 133 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.63E-39 | 28 | 137 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.3E-27 | 31 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.2E-18 | 58 | 76 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.2E-18 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 7.2E-18 | 96 | 114 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
MADYSNSGDG GGGSIGNGGE DGVVIEHEKL LPIANVGRIM KQILPSNAKI SKEAKETMQE 60 CVSEFISFVT GEASEKCRRE RRKTVNGDDV CWALASLGFD DYVGPLKRYL HKYREAEGER 120 SSNNVSQNHK ATNNNNNLYN * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 1e-43 | 19 | 115 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_287.4 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021912306.1 | 1e-85 | nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 2e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | Q75IZ7 | 3e-54 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A067K777 | 1e-63 | A0A067K777_JATCU; Uncharacterized protein | ||||
| STRING | evm.model.supercontig_287.4 | 1e-100 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 7e-57 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_287.4 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




