![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_29.114 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 98aa MW: 11218.3 Da PI: 9.5658 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53 | 8e-17 | 14 | 60 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g+WT+eEd++l++ + G +W+++++ g++R++k+c++rw +y
evm.model.supercontig_29.114 14 KGPWTAEEDKKLINFIITNGHCCWRAVPKLAGLRRCGKSCRLRWTNY 60
79********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 5.1E-22 | 5 | 63 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 19.872 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 9.1E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.6E-15 | 14 | 60 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 4.15E-19 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.32E-9 | 16 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 4.077 | 62 | 97 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 6.5E-5 | 64 | 87 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MGRQPCCDKL GVKKGPWTAE EDKKLINFII TNGHCCWRAV PKLAGLRRCG KSCRLRWTNY 60 FRPDLKRGLL TDFEEQLVID LHARLGNSLL TCKLCWI* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_29.114 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021725517.1 | 2e-57 | protein ODORANT1-like | ||||
| Refseq | XP_021901708.1 | 8e-59 | protein ODORANT1, partial | ||||
| Swissprot | Q50EX6 | 2e-53 | ODO1_PETHY; Protein ODORANT1 | ||||
| TrEMBL | A0A218WGN9 | 8e-55 | A0A218WGN9_PUNGR; Uncharacterized protein | ||||
| TrEMBL | A0A2I0JT83 | 3e-55 | A0A2I0JT83_PUNGR; Uncharacterized protein | ||||
| TrEMBL | W9QU23 | 2e-54 | W9QU23_9ROSA; Protein ODORANT1 | ||||
| STRING | evm.model.supercontig_29.114 | 1e-65 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G12350.1 | 3e-56 | myb domain protein 42 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_29.114 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




