PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.model.supercontig_3097.1

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

GRAS

Protein Properties

Length: 109aa MW: 12746.6 Da PI: 9.1227

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_3097.1	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	127.6	1.4e-39	2	107	267	373
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347 lf+s++++++r+ +eri+vE+++l+r+ivn+vaceg+er+erhe ++kW++rl++aGF++++ls ++++ +++llr ++ + evm.model.supercontig_3097.1 2 LFESIDVTMGRDRKERINVEQHCLARDIVNIVACEGKERVERHELFGKWKSRLTMAGFRQYSLSPYVNSAIRSLLRYYS-E 81 8*************************************************************************999.6 PP GRAS 348 gyrveeesgslvlgWkdrpLvsvSaW 373 y++ee++g+++lgWkdr+L+s+SaW evm.model.supercontig_3097.1 82 HYKLEEKDGAMLLGWKDRNLISASAW 107 6*********************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50985	18.477	1	89	IPR005202	Transcription factor GRAS
Pfam	PF03514	4.6E-37	2	107	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
QLFESIDVTM GRDRKERINV EQHCLARDIV NIVACEGKER VERHELFGKW KSRLTMAGFR 60 QYSLSPYVNS AIRSLLRYYS EHYKLEEKDG AMLLGWKDRN LISASAWH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5b3h_A	3e-13	2	107	272	377	Protein SCARECROW
5b3h_D	3e-13	2	107	272	377	Protein SCARECROW
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269\|PubMed:12591613}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_3097.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269\|PubMed:12591613}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028126203.1	1e-63	scarecrow-like protein 21
Refseq	XP_028126224.1	2e-64	chitin-inducible gibberellin-responsive protein 1-like
Swissprot	Q69VG1	3e-54	CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBL	A0A061F6I6	5e-62	A0A061F6I6_THECC; GRAS family transcription factor isoform 2
TrEMBL	D4QD66	6e-62	D4QD66_DIACA; GRAS family transcription factor
STRING	evm.model.supercontig_3097.1	1e-75	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM31727	2	2
Representative plant	OGRP14896	4	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G48150.2	2e-52	GRAS family protein

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_3097.1

Publications ? help Back to Top
Day RB, et al. Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells. Plant Mol. Biol., 2004. 54(2): p. 261-72 [PMID:15159627]