PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.model.supercontig_331.6

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

LBD

Protein Properties

Length: 59aa MW: 6514.69 Da PI: 10.3007

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_331.6	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	72.6	7.6e-23	13	59	1	47
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+Ca++Cv+apyfpa++p+kfa vhk+FGasnv k+l+ evm.model.supercontig_331.6 13 PCAACKLLRRRCAQECVFAPYFPADEPQKFASVHKVFGASNVNKMLQ 59 7********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	18.145	12	59	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	5.8E-22	13	59	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MKVSGRKQGA LSPCAACKLL RRRCAQECVF APYFPADEPQ KFASVHKVFG ASNVNKMLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	5e-22	9	59	7	57	LOB family transfactor Ramosa2.1
5ly0_B	5e-22	9	59	7	57	LOB family transfactor Ramosa2.1
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_331.6

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002513395.1	1e-35	LOB domain-containing protein 4
Refseq	XP_021644716.1	1e-35	LOB domain-containing protein 4-like
Swissprot	Q9SHE9	1e-32	LBD4_ARATH; LOB domain-containing protein 4
TrEMBL	A0A2P5DV54	2e-34	A0A2P5DV54_PARAD; Lateral organ boundaries domain containing protein
STRING	evm.model.supercontig_331.6	2e-36	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM131	28	340
Representative plant	OGRP60	16	318

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G31320.1	4e-35	LOB domain-containing protein 4

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_331.6