![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_34.62 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 125aa MW: 14767.7 Da PI: 9.8281 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.8 | 9.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT+eEd +l+ +v+++G +W+ +r g+ R++k+c++rw +yl
evm.model.supercontig_34.62 14 KGTWTPEEDRKLIAYVTRYGCWNWRQLPRFAGLARCGKSCRLRWMNYL 61
799*****************99************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 50.6 | 4.3e-16 | 67 | 109 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
rg+ T+eE++ ++++++ lG++ W++Ia+++ gRt++++k++w
evm.model.supercontig_34.62 67 RGNYTKEEEDTILRLHETLGNK-WSAIAAHLA-GRTDNEIKNHWA 109
899*******************.*********.***********6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 22.69 | 9 | 65 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.91E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.8E-10 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.7E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 8.7E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.25E-8 | 16 | 61 | No hit | No description |
| SMART | SM00717 | 1.2E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 14.581 | 66 | 116 | IPR017930 | Myb domain |
| Pfam | PF00249 | 6.3E-15 | 67 | 108 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 6.6E-24 | 69 | 111 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.64E-9 | 69 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MVRTPSFDEN GLKKGTWTPE EDRKLIAYVT RYGCWNWRQL PRFAGLARCG KSCRLRWMNY 60 LRPNIKRGNY TKEEEDTILR LHETLGNKWS AIAAHLAGRT DNEIKNHWAH HPQETQFENE 120 RNQL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 4e-26 | 12 | 108 | 5 | 100 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. | |||||
| UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_34.62 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021901070.1 | 1e-89 | transcription factor MYB4-like | ||||
| Swissprot | Q7XBH4 | 7e-52 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
| Swissprot | Q9S9Z2 | 3e-51 | MYB93_ARATH; Transcription factor MYB93 | ||||
| TrEMBL | A0A1R3JCN6 | 1e-67 | A0A1R3JCN6_COCAP; Uncharacterized protein | ||||
| STRING | evm.model.supercontig_34.62 | 4e-89 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34670.1 | 1e-53 | myb domain protein 93 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_34.62 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




