![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_48.72 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 135aa MW: 15082.8 Da PI: 5.0201 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 157.8 | 1.8e-49 | 3 | 97 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
++d++lPianv+r+mk+vlP akisk+ak+t+qec++efisfvt+easdkc++e+rkt+ngdd++wa++ lGf++y+e++ y
evm.model.supercontig_48.72 3 DEDKLLPIANVGRLMKQVLPPSAKISKEAKQTMQECATEFISFVTAEASDKCHKENRKTVNGDDICWAFSALGFDEYAEAIIRY 86
79********************************************************************************** PP
NF-YB 87 lkkyrelegek 97
l+kyre+e++k
evm.model.supercontig_48.72 87 LHKYREAERQK 97
********986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.3E-49 | 3 | 123 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.58E-39 | 4 | 119 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.1E-25 | 8 | 70 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.7E-17 | 35 | 53 | No hit | No description |
| PRINTS | PR00615 | 2.7E-17 | 54 | 72 | No hit | No description |
| PRINTS | PR00615 | 2.7E-17 | 73 | 91 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MVDEDKLLPI ANVGRLMKQV LPPSAKISKE AKQTMQECAT EFISFVTAEA SDKCHKENRK 60 TVNGDDICWA FSALGFDEYA EAIIRYLHKY REAERQKANQ NKPANAQDKD EESNRSGQPS 120 SQQIDSNTAP IEFS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 8e-39 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 8e-39 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_48.72 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021898882.1 | 4e-97 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 1e-59 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A061F331 | 1e-70 | A0A061F331_THECC; Nuclear transcription factor Y subunit B-4 | ||||
| STRING | evm.model.supercontig_48.72 | 2e-96 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 5e-62 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_48.72 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




