![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_49.32 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 157aa MW: 18057.7 Da PI: 7.446 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 82.9 | 4.8e-26 | 26 | 86 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
Fl+k+y++++d+++++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y +
evm.model.supercontig_49.32 26 FLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYVY 86
9**********************************************************76 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 4.0E-28 | 18 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.3E-27 | 22 | 127 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 8.16E-25 | 25 | 99 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 2.9E-16 | 26 | 49 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 6.3E-22 | 26 | 86 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.9E-16 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.9E-16 | 77 | 89 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 157 aa Download sequence Send to blast |
MAALMLDNCE GILLSLDSHK SVPAPFLTKT YQLVDDPSTD HIVSWGEDDT TFVVWRPPEF 60 ARDLLPNYFK HNNFSSFVRQ LNTYVYYIYP PTYISSMLYI NSMALLIWVL CFWVVDGTRV 120 LGRLYLTDGS LQTSSSRRER SICCVRSTEG KQHSRR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 3e-16 | 21 | 86 | 25 | 89 | Heat shock factor protein 1 |
| 5d5v_B | 3e-16 | 21 | 86 | 25 | 89 | Heat shock factor protein 1 |
| 5d5v_D | 3e-16 | 21 | 86 | 25 | 89 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_49.32 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021898582.1 | 6e-55 | heat stress transcription factor B-4 | ||||
| Swissprot | Q7XHZ0 | 2e-40 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
| TrEMBL | A0A068U135 | 9e-53 | A0A068U135_COFCA; Uncharacterized protein | ||||
| TrEMBL | A0A2G2VBY3 | 3e-52 | A0A2G2VBY3_CAPBA; Heat stress transcription factor B-4 | ||||
| TrEMBL | A0A2G2Y0E5 | 3e-52 | A0A2G2Y0E5_CAPAN; Heat stress transcription factor B-4 | ||||
| TrEMBL | A0A2G3CQ07 | 3e-52 | A0A2G3CQ07_CAPCH; Heat stress transcription factor B-4 | ||||
| STRING | evm.model.supercontig_49.32 | 1e-113 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2900 | 28 | 66 | Representative plant | OGRP96 | 17 | 233 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G46264.1 | 2e-40 | heat shock transcription factor B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_49.32 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




