PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.model.supercontig_566.3

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

NAC

Protein Properties

Length: 94aa MW: 10951.8 Da PI: 4.158

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_566.3	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	53.7	6.9e-17	44	90	2	49
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp evm.model.supercontig_566.3 44 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPG 90 79*************************.89************94 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.44E-17	42	92	IPR003441	NAC domain
PROSITE profile	PS51005	20.371	43	93	IPR003441	NAC domain
Pfam	PF02365	4.4E-8	45	86	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MAIAAANMSN NSSEDNNRNN NEEEGSGDHQ VVDDDDHHEQ DMVMPGFRFH PTEEELVEFY 60 LRRKVEGKRF NVELITFLDL YRYDPWELPG TYN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	9e-15	27	89	1	63	NO APICAL MERISTEM PROTEIN
1ut4_B	9e-15	27	89	1	63	NO APICAL MERISTEM PROTEIN
1ut7_A	9e-15	27	89	1	63	NO APICAL MERISTEM PROTEIN
1ut7_B	9e-15	27	89	1	63	NO APICAL MERISTEM PROTEIN
4dul_A	9e-15	27	89	1	63	NAC domain-containing protein 19
4dul_B	9e-15	27	89	1	63	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_566.3

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021905339.1	4e-59	LOW QUALITY PROTEIN: NAC domain-containing protein 35
Swissprot	Q9ZVP8	3e-29	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A0B2S4L3	9e-35	A0A0B2S4L3_GLYSO; NAC domain-containing protein 35
TrEMBL	I1KNQ2	9e-35	I1KNQ2_SOYBN; Uncharacterized protein
STRING	evm.model.supercontig_566.3	9e-64	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.2	4e-28	NAC domain containing protein 35

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_566.3

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]