![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_638.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 89aa MW: 9886.79 Da PI: 10.4018 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 135.3 | 1.5e-42 | 22 | 88 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ +e kG+nPGlivllvvgglll+fl+gny+ly+yaqk+lPP+kkkP+skkk+k+eklkqG+++PGe
evm.model.supercontig_638.2 22 NDAEIKGFNPGLIVLLVVGGLLLTFLIGNYVLYTYAQKTLPPKKKKPISKKKMKKEKLKQGISAPGE 88
6789**************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 3.0E-4 | 19 | 88 | No hit | No description |
| Pfam | PF04689 | 6.0E-40 | 24 | 88 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MEEEFVDFSD RVPPNINRVK INDAEIKGFN PGLIVLLVVG GLLLTFLIGN YVLYTYAQKT 60 LPPKKKKPIS KKKMKKEKLK QGISAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_638.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021903755.1 | 2e-56 | DNA-binding protein S1FA-like | ||||
| Swissprot | Q7XLX6 | 2e-15 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
| TrEMBL | W9SCA3 | 7e-26 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
| STRING | evm.model.supercontig_638.2 | 8e-56 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2823 | 27 | 69 | Representative plant | OGRP5095 | 13 | 22 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_638.2 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




