![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_77.14 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 49aa MW: 5489.34 Da PI: 5.5869 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 27 | 1.4e-08 | 12 | 45 | 30 | 63 |
YABBY 30 slfkvvtvrCGhCtsllsvnlakasqllaaeshl 63
lf+++tvrCGhCt++ v++ a q +++++
evm.model.supercontig_77.14 12 NLFEIMTVRCGHCTNVCYVDMGAAFQYSMSSKDV 45
589******************9988776666654 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 2.1E-7 | 12 | 45 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 49 aa Download sequence Send to blast |
MQYNTELFTA INLFEIMTVR CGHCTNVCYV DMGAAFQYSM SSKDVQVK* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_77.14 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021895008.1 | 9e-19 | axial regulator YABBY 5-like isoform X2 | ||||
| STRING | evm.model.supercontig_77.14 | 9e-29 | (Carica papaya) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 4e-08 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_77.14 |




