![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_77.16 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 66aa MW: 7426.69 Da PI: 7.7384 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 58.2 | 3.7e-18 | 7 | 63 | 5 | 61 |
YABBY 5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61
+ e++Cy+ C++C+ ++av vP +sl+ +vt+rC hC++l svn+a + q +++++
evm.model.supercontig_77.16 7 FECERLCYMPCKHCKIVVAVRVPCSSLYDIVTIRCVHCSNLWSVNMAATLQSMSTQD 63
5689*******************************************9999988876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 1.5E-18 | 9 | 62 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MSSSNGFECE RLCYMPCKHC KIVVAVRVPC SSLYDIVTIR CVHCSNLWSV NMAATLQSMS 60 TQDLHQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_77.16 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021895056.1 | 1e-42 | axial regulator YABBY 5-like isoform X1 | ||||
| Swissprot | Q8GW46 | 1e-22 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
| TrEMBL | A0A2G5DFY8 | 3e-22 | A0A2G5DFY8_AQUCA; Uncharacterized protein | ||||
| STRING | evm.model.supercontig_77.16 | 3e-42 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5538 | 26 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 5e-25 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_77.16 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




