![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_99.63 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 210aa MW: 24016.2 Da PI: 9.9375 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 161.9 | 2.4e-50 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82
lppGfrFhPtd+el+ +yLk+kv + +l++ ++i+e+d++k++PwdLp e+e yfFs+r+ ky++gkr+nrat sgy
evm.model.supercontig_99.63 14 LPPGFRFHPTDQELLLDYLKRKVFSCPLPA-SIIPELDVCKADPWDLPGD---WEEERYFFSRREAKYPNGKRSNRATGSGY 91
79****************************.89***************44...46799************************ PP
NAM 83 Wkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
Wkatg dk+++s+ ++++vglkktLvfy+g+ p+g++tdW+mheyrl
evm.model.supercontig_99.63 92 WKATGIDKQIVSAsGKHVVGLKKTLVFYRGKPPHGSRTDWIMHEYRL 138
***********9967788***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.22E-60 | 10 | 159 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 57.658 | 14 | 159 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.1E-26 | 15 | 138 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0010089 | Biological Process | xylem development | ||||
| GO:0010150 | Biological Process | leaf senescence | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 210 aa Download sequence Send to blast |
MEKLNFVKNG VVRLPPGFRF HPTDQELLLD YLKRKVFSCP LPASIIPELD VCKADPWDLP 60 GDWEEERYFF SRREAKYPNG KRSNRATGSG YWKATGIDKQ IVSASGKHVV GLKKTLVFYR 120 GKPPHGSRTD WIMHEYRLHS SVSNQMRKEK WVVCRIFLKK RGTKNQNPVF YDFLRSDSSS 180 SSGSSGITQV SCNESDDHEE SSKSNFNSF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-48 | 12 | 160 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-48 | 12 | 160 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-48 | 12 | 160 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-48 | 12 | 160 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 3e-48 | 12 | 160 | 18 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 3e-48 | 12 | 160 | 15 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 3e-48 | 12 | 160 | 15 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00507 | DAP | Transfer from AT5G13180 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_99.63 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021892824.1 | 1e-156 | NAC domain-containing protein 83 | ||||
| Swissprot | Q9FY93 | 1e-89 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
| TrEMBL | A0A218L0U9 | 1e-154 | A0A218L0U9_CARPA; NAC4 protein | ||||
| STRING | evm.model.supercontig_99.63 | 1e-155 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1806 | 27 | 86 | Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13180.1 | 1e-91 | NAC domain containing protein 83 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_99.63 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




