![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00002.466 | ||||||||
| Common Name | AMTR_s00002p00262770 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 74aa MW: 8329.65 Da PI: 10.8468 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.5 | 4.8e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krie+ +nrqvtfskRr+g+lKKA+ELS+LCda+ +i+fss+gk+yeys+
evm_27.model.AmTr_v1.0_scaffold00002.466 9 KRIEDRTNRQVTFSKRRTGLLKKAHELSILCDAQLGLIVFSSSGKMYEYSN 59
79***********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.8 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.01E-38 | 2 | 65 | No hit | No description |
| SuperFamily | SSF55455 | 3.01E-30 | 2 | 67 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.4E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MGRGKIEIKR IEDRTNRQVT FSKRRTGLLK KAHELSILCD AQLGLIVFSS SGKMYEYSNP 60 PSRSVFLPFT STH* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 9e-24 | 2 | 71 | 1 | 70 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 9e-24 | 2 | 71 | 1 | 70 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 9e-24 | 2 | 71 | 1 | 70 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 9e-24 | 2 | 71 | 1 | 70 | Myocyte-specific enhancer factor 2A |
| 6byy_A | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| 6byy_B | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| 6byy_C | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| 6byy_D | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| 6bz1_A | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| 6bz1_B | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| 6bz1_C | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| 6bz1_D | 1e-23 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020520175.1 | 1e-37 | MADS-box protein GGM13 | ||||
| Refseq | XP_020520176.1 | 1e-37 | MADS-box protein GGM13 | ||||
| Swissprot | Q84NC2 | 2e-30 | MAD31_ORYSJ; MADS-box transcription factor 31 | ||||
| Swissprot | Q9XGJ4 | 3e-30 | GGM13_GNEGN; MADS-box protein GGM13 | ||||
| TrEMBL | W1P358 | 8e-47 | W1P358_AMBTC; Uncharacterized protein | ||||
| STRING | ERN01390 | 1e-47 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09960.2 | 4e-31 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00002.466 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




