![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00004.51 | ||||||||
| Common Name | AMTR_s00004p00067720 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 105aa MW: 12064.5 Da PI: 9.8404 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 76.6 | 2.9e-24 | 8 | 65 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dg+ WrKYGqK +++ + rsY++C ++C ++k+ve +++dp+ + ++Y g+H h+
evm_27.model.AmTr_v1.0_scaffold00004.51 8 EDGFVWRKYGQKFIRNIRKNRSYFKCQKKSCGARKRVEWCNSDPQNLRVIYDGSHSHP 65
7********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 21.448 | 2 | 67 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.45E-23 | 4 | 67 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 5.9E-25 | 5 | 67 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.0E-23 | 7 | 66 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.0E-22 | 8 | 65 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MDRVCMPEDG FVWRKYGQKF IRNIRKNRSY FKCQKKSCGA RKRVEWCNSD PQNLRVIYDG 60 SHSHPPPISS KTSDDDHQNP SSSIANQYNL LTQVLRGLND TTTT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 4e-14 | 4 | 67 | 14 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 4e-14 | 4 | 67 | 14 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006488951.1 | 3e-35 | probable WRKY transcription factor 23 | ||||
| Refseq | XP_024047358.1 | 3e-35 | probable WRKY transcription factor 23 | ||||
| TrEMBL | W1NEF1 | 5e-73 | W1NEF1_AMBTC; Uncharacterized protein | ||||
| STRING | ERM93535 | 8e-74 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP14 | 17 | 875 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49520.1 | 6e-17 | WRKY DNA-binding protein 48 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00004.51 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




