PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm_27.model.AmTr_v1.0_scaffold00013.61

Common Name

AMTR_s00013p00129310

Organism

Amborella trichopoda

Taxonomic ID

13333

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

NF-YB

Protein Properties

Length: 75aa MW: 8560.85 Da PI: 9.1511

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00013.61	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	105.5	3.6e-33	1	68	17	84
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 mkk+l anakiskdaketvqec+sefisf t easdk qre rktin dd+lwa++t+Gfe+yv +++ evm_27.model.AmTr_v1.0_scaffold00013.61 1 MKKALLANAKISKDAKETVQECISEFISFKTREASDKYQRETRKTINRDDFLWAMTTIGFEEYVRAIE 68 9***************************************************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	6.1E-28	1	68	IPR009072	Histone-fold
SuperFamily	SSF47113	3.19E-20	1	68	IPR009072	Histone-fold
Pfam	PF00808	1.1E-15	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.2E-10	19	37	No hit	No description
PRINTS	PR00615	2.2E-10	38	56	No hit	No description
PRINTS	PR00615	2.2E-10	57	74	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MKKALLANAK ISKDAKETVQ ECISEFISFK TREASDKYQR ETRKTINRDD FLWAMTTIGF 60 EEYVRAIEGL PAKV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	9e-24	1	67	17	83	Transcription factor HapC (Eurofung)
4g92_B	9e-24	1	67	17	83	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006586138.1	1e-32	nuclear transcription factor Y subunit B-3
Refseq	XP_006602134.1	7e-33	nuclear transcription factor Y subunit B-3
Refseq	XP_013460047.1	7e-33	nuclear transcription factor Y subunit B-3
Refseq	XP_028214205.1	7e-33	nuclear transcription factor Y subunit B-3-like
Refseq	XP_028246114.1	9e-33	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	2e-32	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q75IZ7	5e-32	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	W1PP96	7e-47	W1PP96_AMBTC; Uncharacterized protein
STRING	ERN09883	1e-47	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	8e-35	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00013.61

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]