![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00044.29 | ||||||||
| Common Name | AMTR_s00044p00058470 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 189aa MW: 21608.2 Da PI: 5.1041 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 104 | 1.9e-32 | 10 | 84 | 53 | 128 |
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWv 122
+++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v+ +++++g+kktLv+ykgrap+g++tdWv
evm_27.model.AmTr_v1.0_scaffold00044.29 10 SRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVCM-QSRAIGMKKTLVYYKGRAPQGVRTDWV 78
4677**************************************.999************************ PP
NAM 123 mheyrl 128
mheyrl
evm_27.model.AmTr_v1.0_scaffold00044.29 79 MHEYRL 84
****98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 39.744 | 1 | 107 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 7.32E-39 | 10 | 108 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.7E-16 | 12 | 84 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 189 aa Download sequence Send to blast |
MSTEKSFLPS RDPEWYFFGP RDRKYPNGFR TNRATRAGYW KSTGKDRRVC MQSRAIGMKK 60 TLVYYKGRAP QGVRTDWVMH EYRLDDKECE DTSGIQDTYA LCRVFKKNVA CPDTEDQGQF 120 TMPLPESLQI SASEYDTVSP EMLHGSSSST CMDVDDKDDA WMQFLMEDAW CSTRANDVES 180 SSCMALTN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 4e-33 | 14 | 108 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-33 | 14 | 108 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-33 | 14 | 108 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-33 | 14 | 108 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 5e-33 | 14 | 108 | 75 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 4e-33 | 14 | 108 | 72 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 4e-33 | 14 | 108 | 72 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020530051.1 | 1e-137 | NAC domain-containing protein 86 | ||||
| Swissprot | A4VCM0 | 7e-53 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
| Swissprot | Q9FFI5 | 7e-53 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
| TrEMBL | U5D4D5 | 1e-139 | U5D4D5_AMBTC; Uncharacterized protein | ||||
| STRING | ERN17060 | 1e-140 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G17730.1 | 3e-83 | NAC domain containing protein 57 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00044.29 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




