![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00048.68 | ||||||||
| Common Name | AMTR_s00048p00125480 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 163aa MW: 18136.3 Da PI: 6.2388 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 98.2 | 5.8e-31 | 1 | 52 | 4 | 55 |
G2-like 4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
evm_27.model.AmTr_v1.0_scaffold00048.68 1 MRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
79*************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| TIGRFAMs | TIGR01557 | 2.6E-23 | 1 | 52 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 5.5E-27 | 1 | 52 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.69E-14 | 1 | 53 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 5.0E-7 | 1 | 51 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 9.094 | 1 | 55 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009887 | Biological Process | organ morphogenesis | ||||
| GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
| GO:0009956 | Biological Process | radial pattern formation | ||||
| GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
| GO:0010158 | Biological Process | abaxial cell fate specification | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDRAA 60 GSSGEIDIFG NGTPGEISNE ILLENMTQRP PLQHGLDYCN MWSNSSSRRN WLQAKSRDSM 120 SMSPSSEVKG GLEDTSDELF EISSSDMNQK KPNLEFTLGR PD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 2e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006854082.2 | 1e-116 | probable transcription factor KAN2 | ||||
| Swissprot | Q9C616 | 4e-43 | KAN2_ARATH; Probable transcription factor KAN2 | ||||
| TrEMBL | U5CZG9 | 1e-117 | U5CZG9_AMBTC; Uncharacterized protein | ||||
| STRING | ERN15549 | 1e-118 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP570 | 15 | 80 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G32240.1 | 3e-42 | G2-like family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00048.68 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




