| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 181 | 2.9e-56 | 15 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyat 70
lppGfrFhPtdeel+++yL+kkv + +++ ++i+evd++k+ePw+Lp+k+k +ekewyfFs rd+ky+t
evm_27.model.AmTr_v1.0_scaffold00058.98 15 LPPGFRFHPTDEELITYYLRKKVLDGGFTA-RAIAEVDLNKCEPWELPEKAKMGEKEWYFFSLRDRKYPT 83
79*************************999.89***************99999***************** PP
NAM 71 gkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
g r+nrat++gyWkatgkd+e++++ + +lvg+kktLvfykgrapkgek++Wvmheyrl
evm_27.model.AmTr_v1.0_scaffold00058.98 84 GLRTNRATEAGYWKATGKDREIYCSrTCSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRL 142
***********************9855667***************************98 PP
|
| Publications
? help Back to Top |
- Vialette-Guiraud AC, et al.
Insights from ANA-grade angiosperms into the early evolution of CUP-SHAPED COTYLEDON genes. Ann. Bot., 2011. 107(9): p. 1511-9 [PMID:21320879] - Wang YX
Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] - Amborella Genome Project
The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] - Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] - Gonçalves B, et al.
A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] - Du Q,Wang H
The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] - Vialette-Guiraud AC, et al.
A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] - Cui X, et al.
REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] - Blein T,Pautot V,Laufs P
Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374] - Biot E, et al.
Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis. Development, 2016. 143(18): p. 3417-28 [PMID:27387872] - Zheng M, et al.
Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development. Plant Physiol., 2016. 172(2): p. 1117-1130 [PMID:27535792] - Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] - Koyama T,Sato F,Ohme-Takagi M
Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] - González-Carranza ZH, et al.
HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] - Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL
Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves. New Phytol., 2018. 217(3): p. 1307-1321 [PMID:29139551] - Gonçalves B, et al.
GDP-L-fucose is required for boundary definition in plants. J. Exp. Bot., 2017. 68(21-22): p. 5801-5811 [PMID:29186469] - Sha S, et al.
To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes. Ann. Bot., 2018. 121(2): p. 255-266 [PMID:29267935] - Maugarny-Calès A, et al.
Dissecting the pathways coordinating patterning and growth by plant boundary domains. PLoS Genet., 2019. 15(1): p. e1007913 [PMID:30677017]
|