PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm_27.model.AmTr_v1.0_scaffold00059.206

Common Name

AMTR_s00059p00187950

Organism

Amborella trichopoda

Taxonomic ID

13333

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

NAC

Protein Properties

Length: 167aa MW: 19690.3 Da PI: 9.7783

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00059.206	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	160.2	8e-50	13	140	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69 l+pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+++ +ekew+f+++rd+ky+ evm_27.model.AmTr_v1.0_scaffold00059.206 13 LMPGFRFHPTEEELVEFYLRRKVEGKRFSV-ELITFLDLYRYDPWELPAHAVIGEKEWFFYVPRDRKYR 80 689*************************.89***********8777899********** PP NAM 70 tgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+r+nr+t+sgyWkatg d+ + + +++ +glkktLvfy+g+apkg++++W+m+eyrl evm_27.model.AmTr_v1.0_scaffold00059.206 81 NGDRPNRVTTSGYWKATGADRMIRGErSSRPIGLKKTLVFYSGKAPKGTRSSWIMNEYRL 140 *******************99857788*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.75E-54	11	146	IPR003441	NAC domain
PROSITE profile	PS51005	51.753	13	157	IPR003441	NAC domain
Pfam	PF02365	8.4E-26	15	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MNDAEKEGGE EVLMPGFRFH PTEEELVEFY LRRKVEGKRF SVELITFLDL YRYDPWELPA 60 HAVIGEKEWF FYVPRDRKYR NGDRPNRVTT SGYWKATGAD RMIRGERSSR PIGLKKTLVF 120 YSGKAPKGTR SSWIMNEYRL PQHETTSADH NHHIFQKQKT YKLEQG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-54	13	140	17	142	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-54	13	140	17	142	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-54	13	140	17	142	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-54	13	140	17	142	NO APICAL MERISTEM PROTEIN
3swm_A	5e-54	13	140	20	145	NAC domain-containing protein 19
3swm_B	5e-54	13	140	20	145	NAC domain-containing protein 19
3swm_C	5e-54	13	140	20	145	NAC domain-containing protein 19
3swm_D	5e-54	13	140	20	145	NAC domain-containing protein 19
3swp_A	5e-54	13	140	20	145	NAC domain-containing protein 19
3swp_B	5e-54	13	140	20	145	NAC domain-containing protein 19
3swp_C	5e-54	13	140	20	145	NAC domain-containing protein 19
3swp_D	5e-54	13	140	20	145	NAC domain-containing protein 19
4dul_A	4e-54	13	140	17	142	NAC domain-containing protein 19
4dul_B	4e-54	13	140	17	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011627776.1	1e-118	NAC domain-containing protein 35 isoform X1
Swissprot	Q9ZVP8	2e-87	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	U5CWF8	1e-120	U5CWF8_AMBTC; Uncharacterized protein
STRING	ERN17661	1e-121	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.1	8e-90	NAC domain containing protein 35

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00059.206

Publications ? help Back to Top
Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]