![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00083.21 | ||||||||
| Common Name | AMTR_s00083p00067130 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 115aa MW: 12461.9 Da PI: 8.8114 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 23.3 | 1.7e-07 | 1 | 31 | 69 | 99 |
DUF260 69 ardPvyGavgvilklqqqleqlkaelallke 99
++dPvyG+vg i+ lq+q+++l++el+++++
evm_27.model.AmTr_v1.0_scaffold00083.21 1 MKDPVYGCVGAISVLQRQVHRLQKELDAANA 31
58************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03195 | 2.4E-5 | 2 | 30 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MKDPVYGCVG AISVLQRQVH RLQKELDAAN ADLIRFACAS PDMHNPILTP DQLLIRRIGN 60 SGSLSHPSLS HQNLTPHSLS HHQGSSDSFP NNGFPPTWSN TSPGGNTRRG ENRM* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-17 | 1 | 38 | 79 | 116 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-17 | 1 | 38 | 79 | 116 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020520762.1 | 3e-80 | LOB domain-containing protein 25 | ||||
| TrEMBL | W1NY08 | 8e-79 | W1NY08_AMBTC; Uncharacterized protein | ||||
| STRING | ERN02517 | 1e-79 | (Amborella trichopoda) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 2e-16 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00083.21 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




