PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm_27.model.AmTr_v1.0_scaffold00096.22

Common Name

AMTR_s00096p00054100, LOC18430463

Organism

Amborella trichopoda

Taxonomic ID

13333

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

YABBY

Protein Properties

Length: 187aa MW: 20980.1 Da PI: 7.1248

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00096.22	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	186.7	1.2e-57	6	163	2	169
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeel 71 ++f+ +eq+CyvqC+fC+til+vsvP +s++k+vtvrCGhC +llsvn++ ++ l+ + sl++++ evm_27.model.AmTr_v1.0_scaffold00096.22 6 HIFEFPEQLCYVQCTFCDTILLVSVPCSSMLKMVTVRCGHCNNLLSVNMKLRASFLPLHL--ISSLTNQV 73 68999*******************************************9999998754..23332222 PP YABBY 72 leelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrik 141 + +l s +++++ + +++ ++ s+ +++e++ +++v++PPekr r+Psaynrfikeeiqr+k evm_27.model.AmTr_v1.0_scaffold00096.22 74 P------TLSL-SLSQASQELRIDTPINT-SSPKKDEITPPKHVNKPPEKRHRAPSAYNRFIKEEIQRLK 135 2......2222.22223333344444444.5555666666788*********************** PP YABBY 142 asnPdishreafsaaaknWahfPkihfg 169 a P i+h+eafsaaaknWahfP+i f+ evm_27.model.AmTr_v1.0_scaffold00096.22 136 AREPTITHKEAFSAAAKNWAHFPRIPFN 163 ***********************885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.2E-64	11	163	IPR006780	YABBY protein
SuperFamily	SSF47095	4.45E-7	106	158	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	5.1E-5	110	158	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0048481	Biological Process	plant ovule development
GO:0005634	Cellular Component	nucleus

Sequence ? help Back to Top
Protein Sequence Length: 187 aa Download sequence Send to blast
MSSCEHIFEF PEQLCYVQCT FCDTILLVSV PCSSMLKMVT VRCGHCNNLL SVNMKLRASF 60 LPLHLISSLT NQVPTLSLSL SQASQELRID TPINTSSPKK DEITPPKHVN KPPEKRHRAP 120 SAYNRFIKEE IQRLKAREPT ITHKEAFSAA AKNWAHFPRI PFNVEADGCT QEEGNGDEVV 180 LMENNE*

Functional Description ? help Back to Top
Source	Description
UniProt	Essential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:9093862, ECO:0000269\|PubMed:9118807}.
UniProt	May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}.
UniProt	May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269\|PubMed:17351053}.
UniProt	Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269\|PubMed:19837869}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:12183381}.
UniProt	INDUCTION: Repressed by WOX3. {ECO:0000269\|PubMed:17351053}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006840679.1	1e-137	axial regulator YABBY 5 isoform X1
Swissprot	Q01JG2	6e-46	YAB5_ORYSI; Protein YABBY 5
Swissprot	Q0JBF0	6e-46	YAB5_ORYSJ; Protein YABBY 5
Swissprot	Q8GW46	4e-47	YAB5_ARATH; Axial regulator YABBY 5
Swissprot	Q9LDT3	3e-46	YAB4_ARATH; Axial regulator YABBY 4
TrEMBL	W1P3Y5	1e-136	W1P3Y5_AMBTC; Uncharacterized protein
STRING	ERN02354	1e-136	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP9612	7	12

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G26580.2	4e-48	YABBY family protein

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00096.22
Entrez Gene	18430463

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Lora J,Hormaza JI,Herrero M Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT). New Phytol., 2015. 208(2): p. 584-95 [PMID:25991552] Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity. Plant Cell, 2015. 27(12): p. 3321-35 [PMID:26589551] Skinner DJ,Brown RH,Kuzoff RK,Gasser CS Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function. BMC Plant Biol., 2016. 16(1): p. 143 [PMID:27350128] Khanday I, et al. Genome-Wide Targets Regulated by the OsMADS1 Transcription Factor Reveals Its DNA Recognition Properties. Plant Physiol., 2016. 172(1): p. 372-88 [PMID:27457124] Simon MK,Skinner DJ,Gallagher TL,Gasser CS Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961]