![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00099.135 | ||||||||
| Common Name | AMTR_s00099p00149290, LOC18427819 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | DBB | ||||||||
| Protein Properties | Length: 187aa MW: 20837.3 Da PI: 6.7033 | ||||||||
| Description | DBB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-B_box | 22.2 | 2.9e-07 | 4 | 47 | 5 | 42 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
C+ +e+ e+ C ++ lC +C ++ H H++vpl
evm_27.model.AmTr_v1.0_scaffold00099.135 4 QCDVCEKAEAAVLCCADEAALCWSCDETVHAAnklaskHQRVPL 47
7*****************************66899999999986 PP
| |||||||
| 2 | zf-B_box | 29.7 | 1.3e-09 | 55 | 89 | 2 | 37 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHkgH 37
++kC+ ++ek +fC +++ llC++C +++H H
evm_27.model.AmTr_v1.0_scaffold00099.135 55 ANPKCDICQEKSGFFFCLEDRALLCRQCDVSIH-TH 89
589*****************************9.65 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50119 | 10.993 | 1 | 47 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 2.26E-6 | 3 | 47 | No hit | No description |
| Pfam | PF00643 | 3.3E-5 | 4 | 47 | IPR000315 | B-box-type zinc finger |
| SMART | SM00336 | 2.4E-10 | 4 | 47 | IPR000315 | B-box-type zinc finger |
| SMART | SM00336 | 9.5E-15 | 54 | 101 | IPR000315 | B-box-type zinc finger |
| PROSITE profile | PS50119 | 9.3 | 54 | 101 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 5.0E-8 | 56 | 89 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 7.64E-7 | 57 | 101 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005622 | Cellular Component | intracellular | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 187 aa Download sequence Send to blast |
MKIQCDVCEK AEAAVLCCAD EAALCWSCDE TVHAANKLAS KHQRVPLLLN SSHHANPKCD 60 ICQEKSGFFF CLEDRALLCR QCDVSIHTHS PYVSSHQRFL LTGVKVGLNH HTSPTPQDSK 120 NENLPNSALP RDQAAGVRPQ WPLDEIFSFP DFDHLDTLSD CGSSQISTRA NNHHHQNHPF 180 LHHQQN* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as positive regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation, independently and in concert with HY5 and BBX21 (PubMed:18540109, PubMed:18796637, PubMed:18182030, PubMed:21427283). Acts as a positive regulator of de-etiolation and influences chloroplast biogenesis and function through regulation of genes encoding chloroplast proteins (PubMed:18182030). Acts downstream of COP1 and plays an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). Regulates the expression of genes responsive to light hormone signals which may contribute to optimal seedling development (PubMed:21427283). {ECO:0000269|PubMed:18182030, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:18796637, ECO:0000269|PubMed:21070414, ECO:0000269|PubMed:21427283}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light. {ECO:0000269|PubMed:18182030}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006836927.1 | 1e-136 | B-box zinc finger protein 22 isoform X2 | ||||
| Swissprot | Q9SYM2 | 3e-59 | BBX22_ARATH; B-box zinc finger protein 22 | ||||
| TrEMBL | W1NWX0 | 1e-135 | W1NWX0_AMBTC; Uncharacterized protein | ||||
| STRING | ERM99780 | 1e-135 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP1804 | 16 | 34 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G78600.1 | 2e-61 | light-regulated zinc finger protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00099.135 |
| Entrez Gene | 18427819 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




