![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00133.18 | ||||||||
| Common Name | AMTR_s00133p00053750 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 112aa MW: 12690.3 Da PI: 10.07 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 87.6 | 2.9e-27 | 31 | 100 | 2 | 71 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71
g+kd hsk++T +RdR vRl a++a++f+d+qd+LG+d++sk+ +W +++akpai+el + + ++s
evm_27.model.AmTr_v1.0_scaffold00133.18 31 IGRKDGHSKVCTVCWPRDRCVRLAAHTAIQFYDVQDRLGYDRPSKAMDWFINKAKPAIDELKKRTHGQSS 100
589**********************************************************999444442 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 9.9E-24 | 32 | 98 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 27.009 | 33 | 91 | IPR017887 | Transcription factor TCP subgroup |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
LENQRRRLSF QSRGGEREIV EVEGGHIVRA IGRKDGHSKV CTVCWPRDRC VRLAAHTAIQ 60 FYDVQDRLGY DRPSKAMDWF INKAKPAIDE LKKRTHGQSS SHGNAPSFWG D* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 9e-16 | 38 | 91 | 1 | 54 | Putative transcription factor PCF6 |
| 5zkt_B | 9e-16 | 38 | 91 | 1 | 54 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 91 | 95 | KKRTH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor playing a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164) (PubMed:12931144, PubMed:17307931). Required during early steps of embryogenesis (PubMed:15634699). Participates in ovule develpment (PubMed:25378179). Activates LOX2 expression by binding to the 5'-GGACCA-3' motif found in its promoter (PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:18816164, ECO:0000269|PubMed:25378179}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the miRNA miR-JAW/miR319 (PubMed:12931144, PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:18816164}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011623141.1 | 1e-60 | transcription factor PCF5, partial | ||||
| Swissprot | Q8LPR5 | 1e-35 | TCP4_ARATH; Transcription factor TCP4 | ||||
| TrEMBL | W1P3H5 | 1e-77 | W1P3H5_AMBTC; Uncharacterized protein (Fragment) | ||||
| STRING | ERN04417 | 2e-78 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP180 | 15 | 163 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15030.3 | 9e-29 | TCP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00133.18 |




