![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00155.46 | ||||||||
| Common Name | AMTR_s00155p00071520 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 170aa MW: 18994.1 Da PI: 9.2213 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 107.4 | 1.2e-33 | 67 | 123 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+Rg+gGrF
evm_27.model.AmTr_v1.0_scaffold00155.46 67 EEPVYVNAKQYHGILRRRQSRAKAESENKL-IKSRKPYLHESRHLHALRRARGCGGRF 123
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 6.2E-38 | 65 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 39.038 | 66 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.8E-28 | 68 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 4.4E-24 | 69 | 91 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 71 | 91 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 4.4E-24 | 100 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
MASPSVEYLM PRSHLEVGHN VQAQPAYPYP DPYYGSLLAA YGAHAVMHPH MMGIHQAGLP 60 LPTDAVEEPV YVNAKQYHGI LRRRQSRAKA ESENKLIKSR KPYLHESRHL HALRRARGCG 120 GRFLNAKTDE DQQNKYEDQQ NNSHHPNNSN SSHNSITLGK EHASAEQAS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-21 | 66 | 130 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006846016.2 | 1e-123 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
| Refseq | XP_020523901.1 | 1e-123 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
| Refseq | XP_020523902.1 | 1e-123 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
| Refseq | XP_020523904.1 | 1e-123 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
| Refseq | XP_020523905.1 | 1e-123 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
| Swissprot | Q84JP1 | 2e-51 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | W1PJ78 | 1e-121 | W1PJ78_AMBTC; Uncharacterized protein | ||||
| STRING | ERN07691 | 1e-122 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP680 | 16 | 72 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 2e-46 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00155.46 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




