PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00176.7
Common NameAMTR_s00176p00025440
Organism
Amborella trichopoda
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HSF
Protein Properties Length: 79aa    MW: 8973.27 Da    PI: 5.5712
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00176.7genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind811.8e-251270260
                                            HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                            HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                                            Fl+k+y++++++++++++sws +g+sfv++d+  f++++Lpk+Fkh+nfaSFvRQLn+Y
  evm_27.model.AmTr_v1.0_scaffold00176.7 12 FLTKTYDMVDEPTTNSMVSWSPSGTSFVIWDPPAFSQNLLPKHFKHRNFASFVRQLNTY 70
                                            9*********************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.106.3E-28570IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004156.5E-22877IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467856.08E-241070IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.2E-211270IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-141235IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-145062IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-146375IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MEKPNDIAIP PFLTKTYDMV DEPTTNSMVS WSPSGTSFVI WDPPAFSQNL LPKHFKHRNF  60
ASFVRQLNTY VDILPECL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A1e-199701778Heat shock factor protein 1
5d5u_B1e-199702687Heat shock factor protein 1
5d5v_B1e-199702687Heat shock factor protein 1
5d5v_D1e-199702687Heat shock factor protein 1
5hdg_A8e-20970768Heat shock factor protein 1
5hdn_A8e-20970768Heat shock factor protein 1
5hdn_B8e-20970768Heat shock factor protein 1
5hdn_C8e-20970768Heat shock factor protein 1
5hdn_D8e-20970768Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849785.21e-43heat stress transcription factor A-1
SwissprotP411517e-27HFA1A_ARATH; Heat stress transcription factor A-1a
TrEMBLW1PMW93e-51W1PMW9_AMBTC; Uncharacterized protein
STRINGERN113675e-52(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9617233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.13e-29heat shock factor 1
Publications ? help Back to Top
  1. Hsu SF,Jinn TL
    AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs.
    Plant Signal Behav, 2010. 5(8): p. 1042-4
    [PMID:20657173]
  2. Liu HC,Charng YY
    Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development.
    Plant Physiol., 2013. 163(1): p. 276-90
    [PMID:23832625]
  3. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  4. Li S, et al.
    HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis.
    Plant Cell, 2014. 26(4): p. 1764-1780
    [PMID:24728648]
  5. Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ
    Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors.
    J. Exp. Bot., 2016. 67(21): p. 6139-6148
    [PMID:27811081]