PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm_27.model.AmTr_v1.0_scaffold00185.21

Common Name

AMTR_s00185p00053620

Organism

Amborella trichopoda

Taxonomic ID

13333

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

BBR-BPC

Protein Properties

Length: 95aa MW: 10402.2 Da PI: 9.973

Description

BBR-BPC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00185.21	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GAGA_bind	231	9.5e-71	1	94	208	301
GAGA_bind 208 lPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGy 277 +P+PvCsCtG+l+qCYkWGnGGWqSaCCtt+iS+yPLPv++++r+aR++grKmS++af+klL++LaaeG+ evm_27.model.AmTr_v1.0_scaffold00185.21 1 MPIPVCSCTGVLQQCYKWGNGGWQSACCTTQISMYPLPVMPNKRHARVGGRKMSGSAFTKLLSRLAAEGH 70 9******************************************************************* PP GAGA_bind 278 dlsnpvDLkdhWAkHGtnkfvtir 301 dls p+DLkdhWAkHGtn+++ti+ evm_27.model.AmTr_v1.0_scaffold00185.21 71 DLSVPLDLKDHWAKHGTNRYITIK 94 *********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF06217	8.2E-68	1	94	IPR010409	GAGA-binding transcriptional activator
SMART	SM01226	2.8E-22	1	94	IPR010409	GAGA-binding transcriptional activator

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009723	Biological Process	response to ethylene
GO:0005730	Cellular Component	nucleolus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MPIPVCSCTG VLQQCYKWGN GGWQSACCTT QISMYPLPVM PNKRHARVGG RKMSGSAFTK 60 LLSRLAAEGH DLSVPLDLKD HWAKHGTNRY ITIK*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00540	DAP	Transfer from AT5G42520	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006852993.3	3e-66	LOW QUALITY PROTEIN: barley B recombinant-like protein D
Swissprot	Q5VSA8	5e-59	BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBL	U5CWE0	7e-65	U5CWE0_AMBTC; Uncharacterized protein
STRING	ERN14459	1e-65	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP2841	13	31

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G42520.3	3e-61	basic pentacysteine 6

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00185.21

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323]