![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm_27.model.AmTr_v1.0_scaffold00357.2 | ||||||||
| Common Name | AMTR_s00357p00009370 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 74aa MW: 8161.31 Da PI: 9.7888 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 72.2 | 1.6e-22 | 2 | 61 | 11 | 70 |
TCP 11 ihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
++T++g+Rd R Rlsa++a++f+dLq +LG+ + sk ++WL++ a+ ai+el++ ++ ++
evm_27.model.AmTr_v1.0_scaffold00357.2 2 VCTAKGLRDQRFRLSAHTAIEFYDLQVSLGYNRSSKGVDWLITRANSAIDELAKPPTWQP 61
7***************************************************99855544 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 20.807 | 1 | 53 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 3.5E-20 | 2 | 55 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MVCTAKGLRD QRFRLSAHTA IEFYDLQVSL GYNRSSKGVD WLITRANSAI DELAKPPTWQ 60 PTTVKPPKPT TGE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 4e-15 | 2 | 53 | 3 | 54 | Putative transcription factor PCF6 |
| 5zkt_B | 4e-15 | 2 | 53 | 3 | 54 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor playing a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164) (PubMed:12931144, PubMed:17307931). Required during early steps of embryogenesis (PubMed:15634699). Participates in ovule develpment (PubMed:25378179). Activates LOX2 expression by binding to the 5'-GGACCA-3' motif found in its promoter (PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:18816164, ECO:0000269|PubMed:25378179}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the miRNA miR-JAW/miR319 (PubMed:12931144, PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:18816164}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004510040.1 | 3e-24 | transcription factor TCP4-like | ||||
| Swissprot | Q8LPR5 | 9e-22 | TCP4_ARATH; Transcription factor TCP4 | ||||
| TrEMBL | W1NTM0 | 8e-48 | W1NTM0_AMBTC; Uncharacterized protein | ||||
| STRING | ERM98545 | 1e-48 | (Amborella trichopoda) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP180 | 15 | 163 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15030.3 | 3e-22 | TCP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm_27.model.AmTr_v1.0_scaffold00357.2 |




