![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | gw1.02.00.531.1 | ||||||||
| Common Name | Nfy, OT_ostta02g01480 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 92aa MW: 10624.2 Da PI: 9.1891 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 176.1 | 3.5e-55 | 1 | 91 | 2 | 92 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
reqdrflP+an+srimkk+lPanak++kd+ketvqecvsefisfvtseasdkcqrekrktingddllwa++tlGfedy++plk+yl+ yr
gw1.02.00.531.1 1 REQDRFLPVANISRIMKKALPANAKVAKDSKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMSTLGFEDYIQPLKLYLHGYRR 91
79****************************************************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-49 | 1 | 91 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.52E-38 | 3 | 91 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.6E-27 | 6 | 70 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.6E-20 | 34 | 52 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 37 | 53 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.6E-20 | 53 | 71 | No hit | No description |
| PRINTS | PR00615 | 2.6E-20 | 72 | 90 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
REQDRFLPVA NISRIMKKAL PANAKVAKDS KETVQECVSE FISFVTSEAS DKCQREKRKT 60 INGDDLLWAM STLGFEDYIQ PLKLYLHGYR RV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-47 | 1 | 90 | 7 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003074932.1 | 3e-64 | Histone-fold | ||||
| Swissprot | P25209 | 1e-57 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| TrEMBL | Q01EQ0 | 7e-63 | Q01EQ0_OSTTA; Histone-fold | ||||
| STRING | Q01EQ0 | 1e-63 | (Ostreococcus tauri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP2023 | 16 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 7e-60 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 9836770 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




