![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | gw1.11.292.1 | ||||||||
| Common Name | CHLNCDRAFT_14739 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 71aa MW: 7647.53 Da PI: 4.1541 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 40 | 9.6e-13 | 12 | 66 | 37 | 91 |
NF-YB 37 ecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
e fi ++t+ a+d c+ kr+ti++dd+l al +l f + vepl+ l+ r
gw1.11.292.1 12 EAGRLFIHYLTATANDACKDAKRQTISADDVLTALEDLDFGELVEPLRSALEGER 66
55567******************************************99887665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.7E-19 | 4 | 63 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.5E-8 | 4 | 46 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 7.65E-17 | 4 | 64 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
TPLQDALLAC AEAGRLFIHY LTATANDACK DAKRQTISAD DVLTALEDLD FGELVEPLRS 60 ALEGERGGTR E |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_005847430.1 | 2e-44 | hypothetical protein CHLNCDRAFT_14739, partial | ||||
| TrEMBL | E1ZFS0 | 5e-43 | E1ZFS0_CHLVA; Uncharacterized protein (Fragment) | ||||
| STRING | XP_005847430.1 | 8e-44 | (Chlorella variabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP3453 | 13 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G27470.1 | 3e-22 | nuclear factor Y, subunit B11 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 17354745 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




