PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID gw1.4.1217.1
Organism
Ostreococcus sp. RCC809
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family Dof
Protein Properties Length: 63aa    MW: 7668.79 Da    PI: 9.9488
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gw1.4.1217.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.23e-32863257
        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
                  ++ +++cprC+s++tkfCyynny+++qPr++C+ C ryWt+GG lrnv vG+grrk
  gw1.4.1217.1  8 PDYHVACPRCKSNETKFCYYNNYNIKQPRFYCRDCCRYWTEGGMLRNVRVGSGRRK 63
                  677899*************************************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-18763IPR003851Zinc finger, Dof-type
PfamPF027017.7E-281163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.1921263IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101450IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
KREQPPKPDY HVACPRCKSN ETKFCYYNNY NIKQPRFYCR DCCRYWTEGG MLRNVRVGSG  60
RRK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00223DAPTransfer from AT1G69570Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001417524.12e-33predicted protein, partial
RefseqXP_022838781.17e-30Zinc finger, Dof-type
SwissprotO229678e-25CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A090M0122e-28A0A090M012_OSTTA; Zinc finger, Dof-type
TrEMBLA0A454XNQ92e-28A0A454XNQ9_OSTTA; Dof domain, zinc finger-domain-containing protein
TrEMBLA4RW534e-32A4RW53_OSTLU; Uncharacterized protein (Fragment)
STRINGABO958177e-33(Ostreococcus 'lucimarinus')
STRINGA0A090M0123e-29(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP46551111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.13e-27Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]