PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

gw1.4.455.1

Common Name

CHLNCDRAFT_15266

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella

Family

Protein Properties

Length: 88aa MW: 10467.9 Da PI: 11.7011

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gw1.4.455.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	35.4	2.5e-11	2	33	15	47
HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqky 47 +v+ +G +W++Ia+++ gR +kqc++rw++ gw1.4.455.1 2 LVRDHGQSNWSLIAKHFS-GRIGKQCRERWHNQ 33 899*************.**********96 PP
2	Myb_DNA-binding	47.1	5.4e-15	40	82	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r +W E+ ll++a+k+ G++ W+ Ia+ ++ gRt++ +k++w+ gw1.4.455.1 40 REAWEGGEERLLIEAHKRIGNK-WADIAKLIP-GRTENAVKNHWN 82 5678888*************.*****.*********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00167	1.94E-7	1	32	No hit	No description
SMART	SM00717	0.12	1	36	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.5E-19	1	41	IPR009057	Homeodomain-like
Pfam	PF00249	7.0E-10	1	34	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	15.642	1	34	IPR017930	Myb domain
SuperFamily	SSF46689	2.21E-25	13	87	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.006	35	88	IPR017930	Myb domain
SMART	SM00717	7.0E-12	39	87	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-13	40	82	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.7E-20	42	88	IPR009057	Homeodomain-like
CDD	cd00167	1.62E-7	47	85	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
RLVRDHGQSN WSLIAKHFSG RIGKQCRERW HNQLRPDIRR EAWEGGEERL LIEAHKRIGN 60 KWADIAKLIP GRTENAVKNH WNATLRRK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269\|PubMed:24068955}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00567	DAP	Transfer from AT5G58850	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	-	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005850135.1	7e-58	hypothetical protein CHLNCDRAFT_15266, partial
Swissprot	Q9FIM4	9e-39	MY119_ARATH; Transcription factor MYB119
TrEMBL	E1Z842	2e-56	E1Z842_CHLVA; Uncharacterized protein (Fragment)
STRING	XP_005850135.1	3e-57	(Chlorella variabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP15	16	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58850.1	4e-41	myb domain protein 119

Link Out ? help Back to Top
Entrez Gene	17357714

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Blanc G, et al. The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex. Plant Cell, 2010. 22(9): p. 2943-55 [PMID:20852019]