![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | gw1.4.467.1 | ||||||||
| Common Name | CHLNCDRAFT_15671 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 54aa MW: 6246.02 Da PI: 9.8878 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 108 | 4.8e-34 | 1 | 53 | 7 | 59 |
zf-Dof 7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
+cprC+s++tkfCyynny++sqPryfC++C+ryWt+GG+lr+v G+grrk+k
gw1.4.467.1 1 PCPRCNSSDTKFCYYNNYNISQPRYFCRTCQRYWTAGGTLRDVAPGAGRRKSK 53
5**************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50884 | 26.729 | 1 | 54 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 7.0E-21 | 1 | 53 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 9.1E-31 | 2 | 53 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 2 | 38 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 54 aa Download sequence Send to blast |
PCPRCNSSDT KFCYYNNYNI SQPRYFCRTC QRYWTAGGTL RDVAPGAGRR KSKS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}. | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00046 | PBM | Transfer from AT5G39660 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_005850474.1 | 3e-33 | hypothetical protein CHLNCDRAFT_15671, partial | ||||
| Swissprot | Q93ZL5 | 6e-26 | CDF2_ARATH; Cyclic dof factor 2 | ||||
| Swissprot | Q9LQX4 | 6e-26 | DOF13_ARATH; Dof zinc finger protein DOF1.3 | ||||
| TrEMBL | E1Z773 | 7e-32 | E1Z773_CHLVA; Uncharacterized protein (Fragment) | ||||
| STRING | XP_005850474.1 | 1e-32 | (Chlorella variabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP4655 | 11 | 11 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G39660.2 | 3e-28 | cycling DOF factor 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 17357536 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




