![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | gw1.9.419.1 | ||||||||
| Common Name | CHLNCDRAFT_17840 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 77aa MW: 8726.02 Da PI: 9.5226 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 85.6 | 6.2e-27 | 3 | 77 | 2 | 76 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
Cq++gC+adls + +y+ r ++C h a++ l +g e rfCq+C+ h l e+D krsCrr La hn+rrrk+
gw1.9.419.1 3 CQADGCRADLSALPRYNVRNHICLEHKAAEAFLKQGAEVRFCQRCGVAHPLGEYDGLKRSCRRMLALHNSRRRKS 77
*************************************************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 22.204 | 1 | 77 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.81E-24 | 3 | 76 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 3.8E-22 | 3 | 64 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.7E-26 | 3 | 76 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
GECQADGCRA DLSALPRYNV RNHICLEHKA AEAFLKQGAE VRFCQRCGVA HPLGEYDGLK 60 RSCRRMLALH NSRRRKS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 1e-15 | 3 | 76 | 11 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 71 | 76 | SRRRKS |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_005847945.1 | 2e-50 | hypothetical protein CHLNCDRAFT_17840, partial | ||||
| TrEMBL | E1ZEB8 | 4e-49 | E1ZEB8_CHLVA; Uncharacterized protein (Fragment) | ||||
| STRING | XP_005847945.1 | 7e-50 | (Chlorella variabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP20 | 12 | 101 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57920.1 | 7e-20 | squamosa promoter binding protein-like 15 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 17355393 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




