PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID gw1.9.427.1
Common NameCHLNCDRAFT_17960
Organism
Chlorella variabilis NC64A
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family SBP
Protein Properties Length: 57aa    MW: 6909.98 Da    PI: 11.6614
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gw1.9.427.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP84.99.9e-271571975
                 HHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
          SBP 19 rrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
                 +r++vC+ h ++p+++v+g+ qrfCqqC+rfh l+efD +kr Cr rL++hn+rrrk
  gw1.9.427.1  1 QRYRVCKPHLQSPAMVVDGVVQRFCQQCGRFHLLREFDGDKRNCRARLQQHNSRRRK 57
                 69******************************************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114122.298157IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.2E-21145IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-23157IPR004333Transcription factor, SBP-box
PfamPF031102.1E-24157IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
QRYRVCKPHL QSPAMVVDGV VQRFCQQCGR FHLLREFDGD KRNCRARLQQ HNSRRRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-162572984squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005847991.11e-34hypothetical protein CHLNCDRAFT_17960, partial
SwissprotQ9SMX97e-19SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A2P6TDT66e-32A0A2P6TDT6_CHLSO; Receptor of activated kinase C component of 40S small ribosomal subunit isoform A
TrEMBLA0A2P6TDV26e-32A0A2P6TDV2_CHLSO; Receptor of activated kinase C component of 40S small ribosomal subunit isoform C
TrEMBLA0A2P6TDV56e-32A0A2P6TDV5_CHLSO; Receptor of activated kinase C component of 40S small ribosomal subunit isoform B
TrEMBLE1ZDN02e-33E1ZDN0_CHLVA; Uncharacterized protein (Fragment)
STRINGXP_005847991.14e-34(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.13e-21squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]