![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | maker-scaffold00195-augustus-gene-1.22-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 108aa MW: 12285.2 Da PI: 10.1486 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.5 | 8.2e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+ie+ks rqvtfskRrng++KKA ELS+LCd+e+a+ ifsstgklyey+s
maker-scaffold00195-augustus-gene-1.22-mRNA-1 10 QIEDKSSRQVTFSKRRNGLMKKARELSILCDVEAALFIFSSTGKLYEYCS 59
79**********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.31 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.3E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 7.95E-34 | 3 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 7.98E-28 | 3 | 65 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.5E-26 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MKRGKLQLNQ IEDKSSRQVT FSKRRNGLMK KARELSILCD VEAALFIFSS TGKLYEYCSS 60 DRFSPFFNFH TPLITKFTVG INMKDSPSCS KINDDRSTLA GFMEAGKQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-19 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_B | 1e-19 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_C | 1e-19 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_D | 1e-19 | 1 | 61 | 1 | 61 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable MADS-box transcription factor that functions with J2 and EJ2 in meristem maturation. {ECO:0000269|PubMed:28528644}. | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| UniProt | Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269|PubMed:15530395, ECO:0000269|PubMed:25183521, ECO:0000269|PubMed:7632923}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023872295.1 | 4e-35 | MADS-box transcription factor 14-like | ||||
| Swissprot | K4BND8 | 7e-23 | MADS4_SOLLC; MADS-box protein 04g005320 | ||||
| Swissprot | P29383 | 8e-23 | AGL3_ARATH; Agamous-like MADS-box protein AGL3 | ||||
| Swissprot | Q9XJ61 | 4e-23 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | A0A2N9IT15 | 2e-29 | A0A2N9IT15_FAGSY; Uncharacterized protein | ||||
| STRING | Pavir.Bb00065.1.p | 1e-25 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03710.3 | 1e-25 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




