![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | maker-scaffold03455-snap-gene-0.16-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | DBB | ||||||||
| Protein Properties | Length: 183aa MW: 20336.1 Da PI: 5.8626 | ||||||||
| Description | DBB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-B_box | 24.8 | 4.4e-08 | 4 | 33 | 5 | 34 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeH 34
C+ +e+ ++++fC ++ lC+ C ++ H
maker-scaffold03455-snap-gene-0.16-mRNA-1 4 LCDVCESAPAIIFCAADEAALCQACDEKVH 33
7**************************998 PP
| |||||||
| 2 | zf-B_box | 28.4 | 3.3e-09 | 52 | 91 | 2 | 37 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHkg....H 37
+ ++C+ +e+ ++ ++Ce +++ lC +C ++ H g H
maker-scaffold03455-snap-gene-0.16-mRNA-1 52 SVPRCDICENAPAFFYCEIDGSSLCLQCDMTVHVGgkrtH 91
5789****************************96544455 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50119 | 10.04 | 1 | 47 | IPR000315 | B-box-type zinc finger |
| SMART | SM00336 | 9.7E-9 | 1 | 47 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 8.3E-7 | 3 | 34 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 1.62E-6 | 3 | 45 | No hit | No description |
| SMART | SM00336 | 3.5E-11 | 51 | 96 | IPR000315 | B-box-type zinc finger |
| PROSITE profile | PS50119 | 9.214 | 51 | 96 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 5.5E-7 | 53 | 90 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 4.62E-7 | 54 | 84 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005622 | Cellular Component | intracellular | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 183 aa Download sequence Send to blast |
MRTLCDVCES APAIIFCAAD EAALCQACDE KVHLCNKLAS RHVRVGLADP SSVPRCDICE 60 NAPAFFYCEI DGSSLCLQCD MTVHVGGKRT HARYLLLRQR IEFPGDKPGR LEELGMQSLD 120 PNQARRELSQ PPTLTMRENQ ENHMPSPVPV LHNNIGGDDN IENQMIDLNT RPQRVHGQAS 180 TNQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). Acts as a negative regulator of blue light-mediated inhibition of hypocotyl elongation through increase of bioactive gibberellin levels (PubMed:20872270). Acts as a repressor of thermotolerance by modulating expression of a set of heat shock-responsive genes (PubMed:23238922). {ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:20872270, ECO:0000269|PubMed:23238922}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By blue light (PubMed:20872270) and heat shock (at protein level) (PubMed:23238922). {ECO:0000269|PubMed:20872270, ECO:0000269|PubMed:23238922}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF145766 | 4e-50 | EF145766.1 Populus trichocarpa clone WS0113_E07 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023884352.1 | 1e-126 | B-box zinc finger protein 18-like isoform X1 | ||||
| Refseq | XP_023884353.1 | 1e-126 | B-box zinc finger protein 18-like isoform X1 | ||||
| Swissprot | Q9SJU5 | 1e-73 | BBX18_ARATH; B-box zinc finger protein 18 | ||||
| TrEMBL | A0A2N9FQ11 | 1e-117 | A0A2N9FQ11_FAGSY; Uncharacterized protein | ||||
| STRING | cassava4.1_016111m | 1e-107 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2734 | 33 | 70 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G21320.1 | 6e-76 | DBB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




