PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03760-augustus-gene-0.13-mRNA-1
Organism
Castanea mollissima
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bHLH
Protein Properties Length: 86aa    MW: 9948.32 Da    PI: 6.672
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03760-augustus-gene-0.13-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH26.98.6e-0913531555
                                                   HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                                            HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                                                   +i++   +L++llP++ + +++ ls +++L +++ YIk Lq
  maker-scaffold03760-augustus-gene-0.13-mRNA-1 13 DIKDLVLKLQSLLPQPNQRRNQTLSASMVLNETCTYIKRLQ 53
                                                   7899999********8899*********************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.05E-81270IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000107.6E-61353IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.3E-81368IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MSSRRSRNFT NEDIKDLVLK LQSLLPQPNQ RRNQTLSASM VLNETCTYIK RLQKEADELS  60
ERLSQLLDSL DTTGVDVELI RTLLQQ
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. Regulates light responses by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20305124}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022775568.11e-26transcription factor PRE6-like
SwissprotF4JCN92e-21PRE4_ARATH; Transcription factor PRE4
TrEMBLB9R9804e-25B9R980_RICCO; DNA binding protein, putative
STRINGXP_002511555.17e-26(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56734143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47710.17e-24BANQUO 3
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]