![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | maker-scaffold07480-snap-gene-0.12-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 97aa MW: 11562.3 Da PI: 9.8892 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 51.3 | 2.6e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W+ eEd +l +++++G+++W+ ++ g+ R++k+c++rw +yl
maker-scaffold07480-snap-gene-0.12-mRNA-1 14 KGAWSVEEDNKLRSYIERFGPENWRELPKFAGLSRCGKSCRLRWMNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.5E-22 | 7 | 63 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 22.779 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 8.5E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.8E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.44E-22 | 15 | 89 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.98E-9 | 16 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 4.635 | 62 | 89 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 9.3E-10 | 64 | 89 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MVRAPFYDKN GLKKGAWSVE EDNKLRSYIE RFGPENWREL PKFAGLSRCG KSCRLRWMNY 60 LQPNLKRGNY TEEEEILIIK LHEELGNKYG LKTSKFF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 2e-17 | 12 | 90 | 25 | 102 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by UV light (PubMed:9839469). Triggered by salicylic acid and jasmonic acid (PubMed:16463103). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023875197.1 | 4e-55 | transcription factor MYB14-like | ||||
| Refseq | XP_023881680.1 | 2e-55 | transcription factor MYB13-like | ||||
| Swissprot | Q6R0A6 | 3e-35 | MYB63_ARATH; Transcription factor MYB63 | ||||
| TrEMBL | A0A2N9J0V5 | 4e-52 | A0A2N9J0V5_FAGSY; Uncharacterized protein | ||||
| STRING | EOX99263 | 3e-48 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF356 | 33 | 186 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G79180.1 | 1e-30 | myb domain protein 63 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




