PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

maker-scaffold09526-snap-gene-0.7-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

SRS

Protein Properties

Length: 103aa MW: 11100.4 Da PI: 9.1615

Description

SRS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
maker-scaffold09526-snap-gene-0.7-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF702	69.4	1.2e-21	11	63	102	154
DUF702 102 tsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 ++s P +v+++avfrc rv++++dg +e+ Yq++vsi+Ghvf+G+LydqG +e maker-scaffold09526-snap-gene-0.7-mRNA-1 11 KKSSPGQVRAPAVFRCHRVTTISDGAAEFVYQATVSISGHVFRGYLYDQGFDE 63 3558**********************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05142	3.7E-19	10	62	IPR007818	Protein of unknown function DUF702
TIGRFAMs	TIGR01624	2.7E-24	15	60	IPR006511	Lateral Root Primordium type 1, C-terminal

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MRDEITDASF KKSSPGQVRA PAVFRCHRVT TISDGAAEFV YQATVSISGH VFRGYLYDQG 60 FDEKNAFPSI SQLHLVSSGS GRKRDASSSP IVAPSNTHLA PVS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269\|PubMed:16740146, ECO:0000269\|PubMed:18835563}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269\|PubMed:18835563}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018849430.1	2e-40	PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
Refseq	XP_018849431.1	2e-40	PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
Refseq	XP_018849432.1	2e-40	PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
Swissprot	Q94CK9	1e-25	LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBL	A0A2N9G8K1	2e-47	A0A2N9G8K1_FAGSY; Uncharacterized protein
STRING	XP_010067729.1	1e-35	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5704	31	54

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G12330.2	4e-28	Lateral root primordium (LRP) protein-related

Publications ? help Back to Top
Estornell LH,Landberg K,Cierlik I,Sundberg E SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis. Front Plant Sci, 2018. 9: p. 150 [PMID:29491878]