![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | maker-scaffold18391-snap-gene-0.8-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 101aa MW: 11685.5 Da PI: 9.589 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 57.1 | 4.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg WT+eEd +++ +v +G g+W++++++ g++R++k+c++rw +yl
maker-scaffold18391-snap-gene-0.8-mRNA-1 14 RGLWTAEEDAKILAYVSNHGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
789*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 7.5E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.361 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.7E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.54E-23 | 16 | 90 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.43E-11 | 17 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 4.344 | 62 | 89 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 3.9E-8 | 65 | 89 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MGRPPCCDKS NVKRGLWTAE EDAKILAYVS NHGIGNWTLV PKKAGLNRCG KSCRLRWTNY 60 LRSDLKHDGF TPQEEELIIN LHKAIGSRWV FKYMTHIFTC Y |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-15 | 14 | 90 | 7 | 82 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Required for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023915988.1 | 5e-63 | transcription factor MYB35 | ||||
| Swissprot | Q9LSI7 | 2e-54 | MYB35_ARATH; Transcription factor MYB35 | ||||
| TrEMBL | A0A2C9UH10 | 1e-60 | A0A2C9UH10_MANES; Uncharacterized protein | ||||
| STRING | cassava4.1_029581m | 3e-59 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2942 | 34 | 74 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28470.1 | 8e-57 | MYB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




