![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | maker-scaffold19642-snap-gene-0.3-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 143aa MW: 16614.1 Da PI: 11.0959 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 44.7 | 3.1e-14 | 11 | 56 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+g+W +eEde l++ vk++G+++W++I ++ + Rt+k+c++rw +
maker-scaffold19642-snap-gene-0.3-mRNA-1 11 KGPWKAEEDEVLLNHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 56
79*************************8887799**********87 PP
| |||||||
| 2 | Myb_DNA-binding | 43.5 | 7.3e-14 | 67 | 106 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+++ eE+ +++ +q+G++ W++Ia +++ gRt++++k++w
maker-scaffold19642-snap-gene-0.3-mRNA-1 67 KFSVEEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 106
799*****************.*********.*********** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.458 | 6 | 62 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.2E-22 | 6 | 59 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 3.2E-29 | 8 | 106 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.9E-11 | 10 | 60 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.94E-10 | 13 | 58 | No hit | No description |
| Pfam | PF13921 | 1.0E-12 | 14 | 64 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.4E-18 | 60 | 112 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 18.315 | 63 | 114 | IPR017930 | Myb domain |
| SMART | SM00717 | 4.4E-12 | 64 | 112 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.4E-12 | 67 | 106 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.66E-9 | 67 | 106 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 143 aa Download sequence Send to blast |
MEVKRNEGIR KGPWKAEEDE VLLNHVKKYG PRDWSSIRSK GLLQRTGKSC RLRWVNKLRP 60 NLKNGCKFSV EEERVVIELQ AQFGNKWARI ATYLPGRTDN DVKNFWSSRQ KRLARILQTS 120 GTANKPQKNK RAVQTCHDVP VSQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 2e-29 | 6 | 112 | 22 | 126 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269|PubMed:15618418, ECO:0000269|PubMed:15694308, ECO:0000269|PubMed:19300502, ECO:0000269|PubMed:21285328, ECO:0000269|PubMed:24876252}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269|PubMed:21441434, ECO:0000269|PubMed:25057814}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023927734.1 | 1e-101 | transcription factor DUO1-like | ||||
| Swissprot | A0A178VEK7 | 3e-73 | DUO1_ARATH; Transcription factor DUO1 | ||||
| TrEMBL | A0A2I4HDR6 | 6e-86 | A0A2I4HDR6_JUGRE; transcription factor MYB57 isoform X1 | ||||
| STRING | XP_009345055.1 | 6e-81 | (Pyrus x bretschneideri) | ||||
| STRING | XP_008356546.1 | 6e-81 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3693 | 31 | 64 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60460.1 | 9e-76 | MYB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




