![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | model.Picochlorum_contig_111.g391.t1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 100aa MW: 11353.9 Da PI: 8.7197 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 132.4 | 1.5e-41 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
mk+ lP+naki+kdak++vqecvsefisf+tseasdkcqrekrktingddllwa+ l f++y++pl++yl+k+r
model.Picochlorum_contig_111.g391.t1 1 MKRSLPKNAKIAKDAKDVVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMDVLFFKEYLQPLTLYLQKFR 75
9************************************************************************** PP
NF-YB 92 elegek 97
e+e+++
model.Picochlorum_contig_111.g391.t1 76 EAEKNE 81
**9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 2.51E-31 | 1 | 92 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.8E-21 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 9.5E-41 | 1 | 95 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 5.3E-17 | 19 | 37 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.3E-17 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 5.3E-17 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MKRSLPKNAK IAKDAKDVVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMDVLFF 60 KEYLQPLTLY LQKFREAEKN ENKSQGHKAS THAESAKGD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 7e-35 | 1 | 76 | 18 | 93 | NF-YB |
| 4awl_B | 7e-35 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 7e-35 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002949581.1 | 3e-44 | hypothetical protein VOLCADRAFT_117284 | ||||
| Swissprot | O23310 | 9e-42 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q9SLG0 | 6e-42 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A0I9QPW0 | 5e-43 | A0A0I9QPW0_VOLCA; CCAAT-box binding factor HAP3-like protein | ||||
| STRING | XP_002949581.1 | 1e-43 | (Volvox carteri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP2023 | 16 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 2e-44 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




