![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | mrna20808.1-v1.0-hybrid | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 225aa MW: 25542.8 Da PI: 8.2458 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 88.9 | 2.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g+lKKAeELSvLCda++a+iifsstgkl+ey+s
mrna20808.1-v1.0-hybrid 9 KKIDNATARQVTFSKRRRGLLKKAEELSVLCDADIALIIFSSTGKLFEYAS 59
68***********************************************86 PP
| |||||||
| 2 | K-box | 31.8 | 5.9e-12 | 92 | 142 | 19 | 69 |
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 30.572 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 6.1E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.02E-40 | 2 | 75 | No hit | No description |
| PRINTS | PR00404 | 3.4E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.01E-31 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.4E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.4E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 7.968 | 87 | 174 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.4E-9 | 92 | 142 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009266 | Biological Process | response to temperature stimulus | ||||
| GO:0009910 | Biological Process | negative regulation of flower development | ||||
| GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0048438 | Biological Process | floral whorl development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0007134 | developmental stage | sporophyte vegetative stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 225 aa Download sequence Send to blast |
MAREKIQIKK IDNATARQVT FSKRRRGLLK KAEELSVLCD ADIALIIFSS TGKLFEYASS 60 SMKEILERHH LHSKNLDKLE QPSLELQLVE NSNYSRLSKE ITAKSHQLRQ MRGEELHGLN 120 LEELQQLEKS LESGMGRVIE KKVVERTDGG RRHVHADSDN RFTEEGQSSE SVTNLCNSNN 180 SPQDYDSSDT SLKLGIDPNK VLRYEGSTLL RRATIFWLTG NSLW* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-22 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_B | 3e-22 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_C | 3e-22 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_D | 3e-22 | 1 | 69 | 1 | 69 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00272 | DAP | Transfer from AT2G22540 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | mrna20808.1-v1.0-hybrid |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP164998 | 1e-136 | KP164998.1 Malus domestica dormancy-associated MADS-box transcription factor (DAM3) mRNA, complete cds. | |||
| GenBank | LC004730 | 1e-136 | LC004730.1 Malus domestica MdJb mRNA for JOINTLESS like protein MdJOINTLESSb, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011468571.1 | 1e-134 | PREDICTED: MADS-box protein JOINTLESS | ||||
| Refseq | XP_011468575.1 | 1e-134 | PREDICTED: MADS-box protein JOINTLESS | ||||
| Swissprot | Q9FUY6 | 7e-93 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
| TrEMBL | A0A2P6RPZ3 | 1e-123 | A0A2P6RPZ3_ROSCH; Putative transcription factor MADS-MIKC family | ||||
| STRING | XP_004288518.1 | 1e-132 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF890 | 33 | 106 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 5e-77 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | mrna20808.1-v1.0-hybrid |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




