![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | mrna35012.1-v1.0-hybrid | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 64aa MW: 7325.26 Da PI: 7.5143 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 47.8 | 4.6e-15 | 8 | 58 | 1 | 51 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51
lp+G+rF+P+de l+++yL+kk ++++ e++ vi+e+d++k+eP+dLp ++
mrna35012.1-v1.0-hybrid 8 LPKGCRFQPSDEVLLSHYLQKKNQRQDPEITAVIPEIDVTKHEPRDLPGEY 58
799***************************999**************9544 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 8.24E-14 | 3 | 58 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 16.68 | 8 | 63 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.0E-5 | 9 | 35 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
MSYGGFSLPK GCRFQPSDEV LLSHYLQKKN QRQDPEITAV IPEIDVTKHE PRDLPGEYQR 60 RPQ* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | mrna35012.1-v1.0-hybrid |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011468877.1 | 2e-31 | PREDICTED: NAC domain-containing protein 4-like isoform X2 | ||||
| TrEMBL | A0A2P6SIY7 | 3e-20 | A0A2P6SIY7_ROSCH; Putative transcription factor NAM family | ||||
| STRING | XP_004308753.1 | 6e-26 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF16106 | 4 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G33060.1 | 1e-12 | NAC 014 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | mrna35012.1-v1.0-hybrid |




