![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g024911m | ||||||||
| Common Name | CISIN_1g011483mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 261aa MW: 28221.5 Da PI: 6.1768 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 108.3 | 3.7e-34 | 82 | 140 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
orange1.1g024911m 82 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHD 140
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.5E-38 | 67 | 142 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.27E-30 | 74 | 142 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 38.147 | 77 | 142 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.2E-39 | 82 | 141 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.5E-26 | 83 | 140 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
| GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 261 aa Download sequence Send to blast |
MDSAATPENS SISVGDDDVD QGSQKSKSGG GGAGGGDDFD EDEPEAKRWK IEGESEGISA 60 PGSRTVREPR VVVQTTSDID ILDDGYRWRK YGQKVVKGNP NPRSYYKCTH PGCPVRKHVE 120 RASHDLRAVI TTYEGKHNHD VPAARGSGSR ALPDNSSNNN HNSNSNSNNN GTLPVRASAV 180 AHHPNNNSIL NPVHNLRVSS SEGQAPYTLE MLQGSGSFGF PGYGNALRSY MNEGQQQDNV 240 LSRAKEEPRD HDTFFESLLF * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-39 | 73 | 143 | 8 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-39 | 73 | 143 | 8 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Csi.237 | 0.0 | fruit| vegetative meristem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000250|UniProtKB:Q6IEQ7}. | |||||
| Uniprot | DEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000269|PubMed:19199048}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in aleurone cells. Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos. {ECO:0000250|UniProtKB:Q6IEQ7}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in aleurone cells (PubMed:15618416). Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos (PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:26025535}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}. | |||||
| UniProt | Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}. | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF708984 | 1e-110 | JF708984.1 Dimocarpus longan WRKY transcription factor 36-3 mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006431962.1 | 1e-171 | WRKY transcription factor WRKY24 | ||||
| Swissprot | Q6B6R4 | 2e-75 | WRK24_ORYSI; WRKY transcription factor WRKY24 | ||||
| Swissprot | Q6IEQ7 | 3e-75 | WRK24_ORYSJ; WRKY transcription factor WRKY24 | ||||
| TrEMBL | A0A067DL38 | 0.0 | A0A067DL38_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A067DTD7 | 0.0 | A0A067DTD7_CITSI; Uncharacterized protein | ||||
| STRING | XP_006431962.1 | 1e-170 | (Citrus clementina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38470.1 | 1e-70 | WRKY DNA-binding protein 33 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g024911m |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




