![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g030909m | ||||||||
| Common Name | CISIN_1g030909mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 170aa MW: 19146 Da PI: 10.2763 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 47.1 | 7.7e-15 | 18 | 63 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrFhP+d+elv++yL kkv++++ ++ ++ vd++k+ePwd+p
orange1.1g030909m 18 LPPGFRFHPRDDELVCDYLMKKVTHTNESI--LLAAVDLNKCEPWDIP 63
79**********************999666..79************98 PP
| |||||||
| 2 | NAM | 80.9 | 2.7e-25 | 64 | 121 | 71 | 129 |
NAM 71 gkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
g r+nrat+sgyWkatgkd+++l+ kg+lvg++ktLvfy+grapkg+kt+Wvmhe+rle
orange1.1g030909m 64 GLRTNRATASGYWKATGKDRAILR-KGSLVGMRKTLVFYRGRAPKGKKTEWVMHEFRLE 121
569********************9.999****************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.35E-42 | 9 | 126 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 26.996 | 18 | 146 | IPR003441 | NAC domain |
| Pfam | PF02365 | 7.4E-23 | 19 | 120 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
MSSSNNSNNN IRMVEAQLPP GFRFHPRDDE LVCDYLMKKV THTNESILLA AVDLNKCEPW 60 DIPGLRTNRA TASGYWKATG KDRAILRKGS LVGMRKTLVF YRGRAPKGKK TEWVMHEFRL 120 EGPFANSPKA SSLKIGCCVE CFTKREKFLA NRAWEAAAMT TQALHHSHH* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-33 | 13 | 141 | 12 | 160 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 3swm_B | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 3swm_C | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 3swm_D | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 3swp_A | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 3swp_B | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 3swp_C | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 3swp_D | 3e-33 | 13 | 141 | 15 | 163 | NAC domain-containing protein 19 |
| 4dul_A | 2e-33 | 13 | 141 | 12 | 160 | NAC domain-containing protein 19 |
| 4dul_B | 2e-33 | 13 | 141 | 12 | 160 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by auxin. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006441024.1 | 1e-82 | NAC domain-containing protein 21/22 | ||||
| Swissprot | Q84TE6 | 4e-59 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
| TrEMBL | A0A067EDZ5 | 1e-125 | A0A067EDZ5_CITSI; Uncharacterized protein | ||||
| STRING | XP_006441024.1 | 5e-82 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3619 | 28 | 59 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56010.2 | 7e-61 | NAC domain containing protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g030909m |




