![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g030981m | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 169aa MW: 19627.8 Da PI: 10.4192 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 97.5 | 5.5e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
orange1.1g030981m 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 56.6 | 1.1e-19 | 82 | 164 | 9 | 83 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK........nellleqieelqkk 83
e ++++ ++e +++ ++e L+ +R+llG++Le++++ eLqqLe+qLe+sl++iR++K n+l++eqie+l++k
orange1.1g030981m 82 IVEDHSQHAKEETSNMMTKLEFLEVAKRKLLGDGLEPCTIDELQQLENQLERSLSRIRARKfrnlvfsqNQLFREQIEKLKEK 164
667899******************************************************95544444466777777777776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.539 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.7E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.36E-41 | 3 | 71 | No hit | No description |
| SuperFamily | SSF55455 | 1.11E-32 | 3 | 73 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.2E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.4E-20 | 84 | 165 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 11.776 | 87 | 168 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010048 | Biological Process | vernalization response | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 169 aa Download sequence Send to blast |
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSSC 60 SINKTIERYQ KKTKDIGINS KIVEDHSQHA KEETSNMMTK LEFLEVAKRK LLGDGLEPCT 120 IDELQQLENQ LERSLSRIRA RKFRNLVFSQ NQLFREQIEK LKEKVITF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 6e-19 | 1 | 84 | 1 | 86 | MEF2C |
| 5f28_B | 6e-19 | 1 | 84 | 1 | 86 | MEF2C |
| 5f28_C | 6e-19 | 1 | 84 | 1 | 86 | MEF2C |
| 5f28_D | 6e-19 | 1 | 84 | 1 | 86 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Csi.9852 | 5e-68 | stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in the outer layers of the root meristem (lateral root cap and epidermis) and in the central cylinder cells of mature roots. Also present in rosette leaves and seedlings and, to a lesser extent, in cauline leaves and flowers. Enriched in apices including the shoot apical meristem and developing leaf primordia. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16778081}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006477351.1 | 1e-115 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
| Refseq | XP_006477352.1 | 1e-115 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
| Refseq | XP_006477353.1 | 1e-115 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
| Refseq | XP_006477354.1 | 1e-115 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
| Swissprot | O82743 | 6e-75 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
| TrEMBL | A0A2H5NTB8 | 1e-107 | A0A2H5NTB8_CITUN; Uncharacterized protein | ||||
| STRING | XP_006477351.1 | 1e-115 | (Citrus sinensis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G22950.1 | 2e-77 | AGAMOUS-like 19 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g030981m |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




